From: Evaluation of the physiological activity of venom from the Eurasian water shrew Neomys fodiens
Sample | Protein name | Species | Accession | Matched peptides | Protein sequence coverage [%] | Ion score | m/z | Identified peptides | Possible toxic activity |
---|---|---|---|---|---|---|---|---|---|
Neomys fodiens | |||||||||
extract | calmodulin-like protein | Mus musculus | Q9D6P8 | 25 | 37 | 64 | 955 | K.EAFSLFDK.D | Acute and chronic effects on cardiac function by regulation of the intracellular Ca2+ concentration [38] |
37 | 4086 | R.SLGQNPTEAELQGMVNEIDKDGNGTVDFPEFLTMMSR.K + Oxidation (M) | |||||||
57 | 4102 | R.SLGQNPTEAELQGMVNEIDKDGNGTVDFPEFLTMMSR.K + 2 Oxidation (M) | |||||||
97 | 1351 | K.MKDTDSEEEIR.E | |||||||
81 | 1367 | K.MKDTDSEEEIR.E + Oxidation (M) | |||||||
65 | 1092 | K.DTDSEEEIR.E | |||||||
hyaluronidase-2 | Bos taurus | Q8SQG8 | 14 | 8 | 24 | 980 | HKMPLDPK | ||
thymosin β-10 | Bos taurus | P21752 | 11 | 11 | 22 | 862 | KTETQEK | Improves cardiac function, promotes vascularization and contractility in heart tissue [52, 53] | |
β-nerve growth factor | Mus musculus | P01139 | 8 | 6 | 68 | 1153 | K.LQHSLDTALR.R | ||
37 | 764 | R.RLHSPR.V | |||||||
fraction no. 5 | cystatin-C | Rattus norvegicus | P14841 | 14 | 8 | 28 | 1207 | GTHTLTKSSCK | Inhibits cysteine proteases, failures in biological mechanisms controlling protease activities may led to many diseases such as neuro-degeneration or cardiovascular diseases [39] |
coagulation factor VIII | Sus scrofa | P12263 | 18 | 5 | 22 | 1427 | ISALGKSAAGPLASGK | Acts as an anti-hemophilic factor [55] | |
lysozyme C-1 | Sus scrofa | P12067 | 6 | 8 | 24 | 930 | YWCNDGK | ||
fraction no. 31 | hyaluronidase PH-20 | Myotis brandtii | gi|521028001 | 14 | 11 | 47 | 1152 | KDIEFYIPK | See above |
fraction no. 34 | chain E, leech-derived tryptase inhibitor Trypsin Complex | Sus scrofa | gi|3318722 | 48 | 21 | 177 | 2210 | R.LGEHNIDVLEGNEQFINAAK.I | Prolongs the blood clotting time by thrombin and trypsin inhibition [57] |
115 | 2282 | K.IITHPNFNGNTLDNDIMLIK.L | |||||||
93 | 1045 | K.LSSPATLNSR.V | |||||||
77 | 841 | R.VATVSLPR.S | |||||||
108 | 1515 | K.SSGSSYPSLLQCLK.A | |||||||
98 | 1051 | K.APVLSDSSCK.S | |||||||
fraction no. 39 | coagulation factor VIII | Sus scrofa | P12263 | 19 | 7 | 23 | 1427 | ISALGKSAAGPLASGK | See above |
lactyloglutathione lyase | Rattus norvegicus | Q6P7Q4 | 17 | 25 | 78 | 1264 | K.DFLLQQTMLR.I | Involved in inflammation [58] | |
54 | 1028 | K.KSLDFYTR.V | |||||||
44 | 900 | K.SLDFYTR.V | |||||||
57 | 976 | K.RFEELGVK.F | |||||||
65 | 2288 | K.GLAFVQDPDGYWIEILNPNK.M | |||||||
fraction no. 40 | phospholipase A2 | Oryctolagus cuniculus | P14422 | 6 | 6 | 27 | 1002 | FAKFLSYK | Exhibits cardio-, myo- and neurotoxicity, as well as pro- and anticoagulant effects [40, 41] |
calmodulin-like protein | Mus musculus | Q9D6P8 | 14 | 5 | 25 | 1367 | MKDTDSEEEIR | See above | |
Sorex araneus | |||||||||
extract | thymosin β-10 | Rattus norvegicus | P63312 | 7 | 34 | 56 | 862 | K.KTETQEK.N | See above |
37 | 734 | K.TETQEK.N | |||||||
48 | 875 | K.ETIEQEK.R | |||||||
77 | 1031 | K.ETIEQEKR.S | |||||||
coagulation factor XI | Mus musculus | Q91Y47 | 10 | 11 | 21 | 846 | MICAGYK | Involved in blood clotting [59] | |
fraction no. 23 | thymosin β-4 | Oryctolagus cuniculus | P34032 | 69 | 88 | 46 | 1245 | M.ADKPDMAEIEK.F | See thymosin β-10 |
47 | 1652 | M.ADKPDMAEIEKFDK.S + Oxidation (M) | |||||||
34 | 862 | K.KTETQEK.N | |||||||
38 | 734 | K.TETQEK.N | |||||||
83 | 1371 | K.TETQEKNPLPSK.E | |||||||
89 | 1512 | K.NPLPSKETIEQEK.Q | |||||||
43 | 875 | K.ETIEQEK.Q | |||||||
72 | 1348 | K.ETIEQEKQAGES.- | |||||||
cystatin-C | Rattus norvegicus | P14841 | 14 | 8 | 27 | 1207 | GTHTLTKSSCK | See above | |
fraction no. 28 | cystatin-C | Rattus norvegicus | P14841 | 11 | 6 | 43 | 1207 | K.GTHTLTKSSCK.N | See above |
lysozyme C-1 | Sus scrofa | P12067 | 10 | 19 | 22 | 787 | AWVAWR | See above | |
kallikrein 1-related peptidase b24 | Mus musculus | Q61754 | 10 | 6 | 33 | 1204 | K.DKSNDLMLLR.L | Might act as an inflammatory agent (increasing vascular permeability and lowering blood pressure) [8, 9] | |
fraction no.29 | cystatin-C | Rattus norvegicus | P14841 | 14 | 8 | 27 | 1207 | GTHTLTKSSCK | See above |
α-amylase 1 | Mus musculus | P00687 | 8 | 11 | 25 | 780 | DYVRTK | Unknown | |
β-defensin 7 | Mus musculus | Q91V70 | 8 | 11 | 24 | 760 | FQIPEK | Exhibits a significant myo- and neurotoxic activity, modifying voltage-sensitive Na+ channels, resulting in a potent analgesic effect [36] |